PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01959.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 799aa    MW: 88806.5 Da    PI: 4.8029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01959.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.7e-14443848
                                    HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    Ede++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Zmw_sc01959.1.g00140.1.sm.mkhc  4 EDEIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 43
                                    9************************.*************97 PP

2Myb_DNA-binding51.22.8e-164991145
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                    + +WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  Zmw_sc01959.1.g00140.1.sm.mkhc 49 KEAWTQEEEIRLIHAHQTYGNK-WAELSKFLP-GRTDNAIKNHWH 91
                                    579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.27147IPR017930Myb domain
PfamPF139219.7E-15460No hitNo description
Gene3DG3DSA:1.10.10.602.4E-22450IPR009057Homeodomain-like
CDDcd001675.50E-12443No hitNo description
SMARTSM007174.6E-8445IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-2923100IPR009057Homeodomain-like
PROSITE profilePS5129420.8234898IPR017930Myb domain
SMARTSM007174.5E-154896IPR001005SANT/Myb domain
CDDcd001671.04E-115191No hitNo description
Gene3DG3DSA:1.10.10.603.1E-225198IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MDYEDEIIIQ MVNKLGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKE AWTQEEEIRL  60
IHAHQTYGNK WAELSKFLPG RTDNAIKNHW HSSVKKKIDS YRASGLLAQF QGIMHVEYPA  120
VSLNIDSSSA MTQQHSEDSG FNVGEVEGST ELSQSSLAKA SCSQEEQIEP SLDSHVHAHN  180
SLCQEPCYTN ADNVASVLPE MQHIADSDED THLQKFSQTT ELPFDIDKEP KNSMSTDMQT  240
SSELAGQLQY TQTMYNSENH GGSFNPYAVD PDVPISMSHN IPKYGHNVDV MCEVGISCDK  300
YLESEPWQGV SFQTVACGSE AENTFSAPLY PLQTSNSSTM IDTGSDGIPN INYESSNFPF  360
FHQDLEGNSC HIASVDPNQQ SYVSSEDDKN RAPEPMENLP ESEKKQLVDI EPSRQPTVTF  420
GKETLSTHCD TVECERNDVE ALCYEPPCFP SFEVPFVRCD LISSSDLPEF SPFGIRELMR  480
SSLNFPTPLR LWSSPPRDGS PDAVLKSAAK SFSSTPSIMK KRPRELSSPC ADIIDEKNLT  540
TEQDCGNLDI SCKIIRRSCL GTADESFDLV SPGEQTGLQQ KKLKLFEENK ENVKEITDQD  600
EIEGNVRGSH LVKGKRCSTV DSDFTSNSHP PGILTQSNAD NLNTPKHEYE YMNIMADTPS  660
VKRGLESPSA WKSPLFTAFQ GAYFMSPAAR AFDALGLVKQ INEQSADALE EAHEVLASGS  720
TKNRHSKGKW DKENTKSSLW KNGLIISKLS SEVMAEARVL DFNDCSTPAR KKDDTNVDSK  780
LRGSASSPVA SSYIRMNVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-3949811105C-Myb DNA-Binding Domain
1msf_C1e-3949811105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
TrEMBLK3Z3V00.0K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879